UniGene Cluster ID;Primary Sequence Cluster Name;Description ...

UniGene Cluster ID;Primary Sequence Cluster Name;Description ... - Related Phones

... ;8;555375;;Dr.76442;0,10422;-2;0,01;-100;0;0;No;-2,48087;0,01282;0,00086; ;No;100;0 ... 1946935;zgc:136279;Zgc:136279;21;678636;hypothetical protein ...

Active

... Hyaloperonospora_arabidopsidis|HpaG812569 ... Phytophthora_infestans|PITG_01204 Phytophthora_parasitica|F443_10032 ...

Active

Ashgrove Surgery is located in Morgan Street, Pontypridd. Ashgrove is a purpose-built Practice with two reception areas; 24 clinical rooms made up of ...

Active

4, CD52, 3.46E-166, 0.40736, 0.995, 0.895, 8.89E-162, 1. 5, S100A6, 4.69E- ... 13, CD8A, 2.90E-121, 0.40336, 0.921, 0.573, 7.45E-117, 1. 14, TXNIP, 5.94E- ...

Active

... NAB2 BM682179 LINC01246 AI018042 CCDC178 AI351607 HIPK1 GHR TET1 ... FH IMMP2L BG686607 AI821210 AA889423 PTX3 ERGIC2 GFM2 SPG21 ...

Active

... 2040800 Aspfo1_0332507 Aspsy1_1043903 2042325 AN4850 Afu3g07480 ... Aacu16872_060148 Aspbr1_0041564 Acar5010_202831 ACLA_024370 ...

Active

19 Apr 2019 ... Journal of Statistical Computation and Simulation., 11, ... (4.85424E-02) (4.91772E-02) (4.91772E-02) (4.68032E-02) (4.68032E-02) ...

Active

2 Dec 2019 ... Replication Factor & Number of Shards (Cluster only): ... AQL function: Unable to lookup analyzer 'default::attribute' (while executing). Edit the ...

Active

Cre16.g651550, Mitochondrial transcription termination factor family protein, AT1G74120 · g16741, calmodulin 6, ACAM-6 CAM6, AT5G21274 · PTHR23050 ...

Active

Ben Wallace. Cluster Manager at DW Fitness First. DW Fitness First. Ipswich, United Kingdom74 connections. Join to Connect · Report this profile ...

Active

DOI: 10.1128/JB.01216-06 ... Buried surface areas were calculated using NACCESS (http://wolf.bms.umist.ac.uk/naccess ). ... structure factors have been deposited in the Protein Data Bank (http://www.rcsb.org/ ) with the accession code 2J2T.

Active

P3.orf0702 mrcA penicillin binding protein 1 A 837211 834671 -2 2541. P3.orf0703 ... TM.orf 1942 ywjl fructose 1 ,6-bisphosphatase II 2151844 2150867 -3 978.

Active

MITIE (OneFM). Building C0656, Sellafield, Seascale, Cumbria, CA20 1PG. Main Contact: Graeme McKenzie-Netherwood, Energy and Sustainability Manager.

Active

The ships were commissioned over a century ago in 1917, when President Woodrow Wilson needed more ships to fight German U-boats. The goal was to build 1,000 in less than two years —...

Active

The survey allowed the research team to focus in on Phoenix, discovered in 2016 during the Dark Energy Survey that scanned the skies between 2013 and 2019. 

Active

... 603 N 75.83 5 1 1 rres049973.v1 AT3G07860.1 38 515 13 490 607 4.8e-173 ... 347 700 390 743 280 1.5e-074 82.00 1 1 1 rres054507.v1 AT5G30495.1 15 ...

Active

... 08I15 IMAGE:124491 R01901;R01948 08I16 IMAGE:125344 R05995;R05994 ... 52I14 IMAGE:302103 N79808;W38311 52I15 IMAGE:301189 W15618 52I16 ...

Active

... aa020950;aa020951 8566 8567 IMAGE:726556 aa394082;aa398115 8568 ... IMAGE:294533 n71027;w01925 8667 IMAGE:363754 aa020835;aa020884 ...

Active

Find out how Dartford Bridge Community Primary School rates compared to other primary schools in Kent with our school ratings.

Active

Dartford Bridge Community Primary School, Dartford. 608 likes · 2 talking about this · 463 were here. A community where all flourish and fulfil potential.

Active

Directory of primary schools in Sutton. ... Name of school: Brookfield Primary School; Address: Brookfield Primary School Ridge Road Sutton; Postcode: SM3 ...

Active

... >tgam01226 142128 141985 -48 MIGNSTSGTSTLWARVSVMSIIPISSRSTSSFSLLLALSISRGLEPNE >tg0145 141914 ... >tgam03433 397843 397700 -48 ...

Active

For activities relating to regulated mortgages and non-investment insurance contracts, Sequence (UK) Limited is an appointed representative of Connells Limited ...

Active

Legal issues[edit]. During a series of legal disputes, Douglas Reuter claimed Jax violated its licensing agreement which ...

Active

Finance This Domain: $2995 12 monthly payments of $250. Start Payment Plan. 12 monthly payments, only $249.58 per month; Start using the domain today ...

Active

no move, no legal fees. If your sale or purchase does not proceed to the exchange of contracts for whatever reason, you will not pay any legal fees.

Active

10613-01-3-300-100. Arviat. 10-05563. 10-05549 ... 10-01276. 10-05530. 10623-01-4-425-100. Kugluktuk. 10-08340. 10-05527. 10624-01-4-420-100.

Active

1 Oct 2019 ... European Patent Convention - This area contains legal texts from the EPO, including the European Patent Convention, Ancillary regulations to ...

Active

... 0.228723 1.23338 0.185444 7.12956e-11 333 Dapma7bEVm004378t1 Dgal ... 2.60492 0.0750781 4.47781e-12 183 Dapma7bEVm021065t1 Dgal nan nan ...

Active

Ex9.3, 18 Find the sum to n terms of the sequence, 8, 88, 888, 8888… 8, 88, 888, 8888… to n term This is not a GP but we can relate it to a GP By writing as Sum ...

Active

... Hordeum vulgare subsp. vulgare AK370281 BAK01482.1 - non-coding 201 ... 22:13:26 12_21137 Hordeum vulgare subsp. vulgare AK359353 BAJ90564.1 ...

Active

William H Brown manage thousands of properties on behalf of our landlords too - so when it comes to buying, selling, renting or letting we've got it covered with ...

Active

... C-SYN01737 SYN01737 AK130681 FLJ27171 C-SYN01861 SYN01861 ... AK299236 FLJ51591 D-THYMU3025407.1 THYMU3025407 AK303466 ...

Active

Incorporated 03 28-01782 Morgan Stanley & Co. ... ALLIANT TECHSYSTEMS INC CORP CV 018804AH7 2111 2065000 SH DEFINED 02 2065000 D ALLIANT ...

Active

... AK000008 ADKA01273 C-ADKA01273 FLJ20001 AK000009 ADKA01577 ... HEP19479 C-HEP19479 FLJ22126 AK025780 HEP19530 C-HEP19530 ...

Active

Brookfield Primary Academy is a primary school in the Sutton Local Education Authority. The school is an average sized mixed gender school. The Ofsted ...

Active

Nucleic Acids Research, Volume 15, Issue 19, 12 October 1987, Pages 7749–7760, https://doi.org/10.1093/nar/15.19.7749. Published: 12 October 1987.

Active

Search.com is the place to finally find an answer to all your searches. Immediate results for any search!

Active

CPn0483 561836 564964 F. CPn0484 564970 565824 F aroG-Deoxyheptonate λldolase- (CT382). CPn0485 566038 566229 F CT382.1 hypothecical procein.

Active

1 Oct 2019 ... European Patent Convention - This area contains legal texts from the EPO, including the European Patent Convention, Ancillary regulations to ...

Active

SEQUENCE LEGAL ADVISORS LTD - Free company information from Companies House including registered office address, filing history, accounts, annual ...

Active

Senior Branch Manager at Jones & Chapman Estate Agents. Sequence (UK) LtdWirral ... May 2018 3 years 3 months. Little Sutton, Cheshire, United Kingdom.

Active

solved/total 21 /120 43 /120 68 /120 66 /120 avg time for solved 19.463. 18.034. 13.286. 13.051 avg bt for solved 245245. 343. 147434. 128. 9 Conclusion.

Active

Information about the legal requirements and documents relating to public auctions within the Sequence group.

Active

1980;208:990–1000. 10. Jetter R, Schäffer S. Chemical composition of the Prunus laurocerasus leaf surface. Dynamic changes of the epicuticular wax film during ...

Active

Law Specialisations. Students completing a Bachelor of Laws, Juris Doctor, Master of Laws or Master of Legal Administration may choose to complete an optional ...

Active

... AK314130 FLJ94827 G-BRTHA2002881_F BRTHA2002881 AK314131 ... C-HRC01527 HRC01527 AK025866 FLJ22213 C-HRC01534 HRC01534 ...

Active

Information about the legal requirements and documents relating to public auctions within the Sequence group.

Active

1 Jan 2020 ... Here Lansdowne Primary School, Gladstone Drive, Sittingbourne, ME10 3BH, is put into focus to show its scores in relation to other schools in ...

Active

Industry: 0161—Vegetables and Melons. Establishments primarily engaged in the production of vegetables and melons in the open. Establishments primarily ...

Active

19 Jan 2008 ... G01204 GOLDEN GATE BAPT THEOL SEMINARY 2 1 0 0 0 7 0 6 16. G01207 ... 002610 FELICIAN COLLEGE 675 409 0 0 0 251 0 187 1,522

Active

28, 1988; 58 FR 38723, July 20, 1993; 68 FR 38628, June 30, 2003; 70 FR 1823, Jan. 11, 2005; 70 FR 54266, Sept. 14, 2005; 78 FR 11055, Feb. 14, 2013] ...

Active

Army S4 soldiers issue and deliver supplies and equipment. ... All military organizations make use of skilled enlisted and officer personnel to keep themselves ...

Active

2000 Oct;267(19):6025-43. doi: 10.1046/j.1432-1327.2000.01679.x. ... The cDNA sequence is 5757 bp in length and codes for a large complex protein ... similarity to yeast chitin synthases with stronger areas of conservation centred on local ...

Active

To assist students to communicate effectively. Student Learning Outcomes. Students with a sequence in legal studies will be able to: Demonstrate an ...

Active

Fox & Sons was established in 1868 on the South Coast are proudly part of the Connells Group which is one of the largest and most successful estate agency ...

Active

These evidence codes are from the Gene Ontology project. Figure 1 ... Strain BD11-00177 was sequenced because of its relevance to biodefense. The draft ...

Active

dave cairms. Credit Controller at Sequence Legal. Sequence Legal. Liverpool, United Kingdom0 connections. Join to Connect · Report this profile ...

Active