RefSeq: NC_002662 - GenomeNet

RefSeq: NC_002662 - GenomeNet - Related Phones

... VRGNPLVFEVGRKPWIIPDNGDVASNQSVINRCPSGALKYLAKEKN" gene 687395..688168 /locus_tag="L_RS03675" /old_locus_tag="L87336" CDS ...

Active

... domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392" ... 458821..458823,458827..458832,458947..458961, 458968..458970 ...

Active

... /locus_tag="AYT26_RS01315" /old_locus_tag="BH_RS01305" /pseudo CDS ... 614532..615113 /locus_tag="AYT26_RS03155" /old_locus_tag="BH0580" ...

Active

... IGSSRSGSKDFEQVVDLYRKYPDIVEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGK TVLKWTI" gene 296167..297861 /locus_tag="USA300HOU_RS01315" ...

Active

... /locus_tag="LMKG_RS02385" /old_locus_tag="LMKG_01445" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_463990.1" /note="Derived by ...

Active

... 388458..389756 /locus_tag="YPD4_RS01905" /old_locus_tag="YPD4_0328" ... complement(756698..757777) /gene="fepB" /locus_tag="YPD4_RS03575" ...

Active

... SPG" gene complement(423398..423832) /locus_tag="LPE509_RS01895" ... /inference="COORDINATES: similar to AA sequence:RefSeq:YP_096068.1" ...

Active

... AIANPFEYAVKVRKYIKETAGI" gene 588629..589639 /gene="iolG" ... /old_locus_tag="D7S_01246" CDS complement(1166629..1167759) ...

Active

SOURCE Haloterrigena turkmenica DSM 5511 ORGANISM Haloterrigena ... b556 subunit" /protein_id="WP_008896324.1" /db_xref="GeneID:8741517" ...

Active

... Region: PRK01269" /db_xref="CDD:234932" gene complement(509105..509695) /gene="yajL" /locus_tag="ECs_0478" CDS complement(509105..509695) ...

Active

... /locus_tag="MESCI_RS01895" /old_locus_tag="Mesci_0378" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_006325405.1" /note="Derived ...

Active

... EEMFSEILADEALWESQFASTDDSKLAELIDVIETEINEGRTRPMFDEHGEFLEYQ" gene complement(568864..570357) /locus_tag="CAUR_RS02245" ...

Active

... /db_xref="RFAM:RF00174" gene complement(295999..299331) /gene="carB" ... CDS complement(325408..326712) /locus_tag="KVU_RS01535" ...

Active

... gene complement(436284..437360) /locus_tag="XCC_RS01895" ... gene complement(470113..470817) /locus_tag="XCC_RS02055" ...

Active

... DNNILEVQVK" gene complement(378243..379121) /locus_tag="DTUR_RS01895" ... F" gene complement(469561..470817) /locus_tag="DTUR_RS02365" ...

Active

... /gene="trmB" /locus_tag="ATU_RS01745" /old_locus_tag="AGR_C_634" ... 471433..472185 /locus_tag="ATU_RS02375" /old_locus_tag="AGR_C_856" ...

Active

... analysis using gene prediction method: tRNAscan-SE." /anticodon=(pos:519033..519035,aa:Met,seq:cat) /db_xref="GeneID:54163120" gene 519240..519695 ...

Active

... ILGEAIHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA" gene 432172..432852 /locus_tag="BAS_RS02225" /old_locus_tag="BAS0399" CDS 432172..432852 ...

Active

... gene complement(280368..281201) /locus_tag="TACI_RS01280" ... AYLRSFRGRGRSSR" gene 360146..361138 /locus_tag="TACI_RS01675" ...

Active

... 305275..305991 /locus_tag="MCA_RS01520" /old_locus_tag="MCA0309" ... /gene="pmbA" /locus_tag="MCA_RS01895" /old_locus_tag="MCA0383" CDS ...

Active

... gene 336573..337313 /locus_tag="STM474_RS01485" ... /old_locus_tag="STM474_0844" /inference="COORDINATES: similar to AA ...

Active

... gene 336573..337313 /locus_tag="SL1344_RS01485" ... /old_locus_tag="SL1344_0844" /inference="COORDINATES: similar to AA ...

Active

... 325494..326183 /gene="eutQ" /locus_tag="CKO_RS01490" /old_locus_tag="CKO_00335" /db_xref="GeneID:45134603" CDS 325494..326183 /gene="eutQ" ...

Active

... PNK" gene complement(355252..356481) /locus_tag="BTB_RS01885" /old_locus_tag="BTB_c03780" CDS complement(355252..356481) ...

Active

... /old_locus_tag="cgp_0111" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_599334.1" /note="Derived by automated computational analysis ...

Active

... gene 327016..327951 /locus_tag="GBS_RS01895" /old_locus_tag="gbs0304" ... 978358..978987 /locus_tag="GBS_RS05080" /old_locus_tag="gbs0936" ...

Active

... gene complement(337139..337714) /locus_tag="FTL_RS01895" ... 960754) /locus_tag="FTL_RS11110" /pseudo CDS complement(960275..>960754) ...

Active

... /locus_tag="ECB_RS02745" /pseudo CDS complement(566292..568529) /gene="nrfB" /locus_tag="ECB_RS02745" /inference="COORDINATES: similar to ...

Active

... 293937..294722 /locus_tag="LL3_RS01550" /old_locus_tag="LL3_00300" ... 1375859..1376134 /locus_tag="LL3_RS07065" /old_locus_tag="LL3_01482" ...

Active

/bound_moiety="glycine" /db_xref="RFAM:RF00504" gene 353998..355335 /locus_tag="SSA_RS01925" /old_locus_tag="SSA_0363" CDS 353998..355335 ...

Active

... gene 253424..253732 /locus_tag="WD_RS01200" /old_locus_tag="WD0269" ... gene complement(308729..309561) /locus_tag="WD_RS06380" CDS ...

Active

... gene complement(393887..396850) /locus_tag="BD_RS01925" /old_locus_tag="Bd0417" ... gene complement(639538..640554) /locus_tag="BD_RS03155" ...

Active

... 276870..278690 /locus_tag="BLON_RS01225" /old_locus_tag="Blon_0231" ... 308088..308402 /locus_tag="BLON_RS01370" /old_locus_tag="Blon_0262" ...

Active

... 250189..251676 /gene="guaB" /locus_tag="LRHM_RS01210" /old_locus_tag="LRHM_0245" /EC_number="1.1.1.205" /inference="COORDINATES: similar to ...

Active

... CDS 344889..346973 /locus_tag="SVEN_RS01530" /old_locus_tag="SMD00853" /old_locus_tag="SVEN_0322" /inference="COORDINATES: similar to AA ...

Active

180039 /locus_tag="M5005_RS09715" /pseudo CDS <179929. ... AQEFYHIQTKIKPIKRT" gene 351409..353406 /gene="metG" /locus_tag="M5005_RS01895" ...

Active

... /gene="yajO" /locus_tag="ECD_RS01925" /old_locus_tag="ECD_00367" CDS ... 909297..909620 /locus_tag="ECD_RS04630" /old_locus_tag="ECD_00871" ...

Active

... /inference="COORDINATES: similar to AA sequence:RefSeq:NP_459136.1" ... gene complement(396132..396734) /locus_tag="KPN_RS01895" ...

Active

... /old_locus_tag="SEN0132" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_459136.1" /note="Derived by automated computational analysis ...

Active

105382) /locus_tag="DEHA2E01254g" /db_xref="GeneID:2902420" mRNA ... ribosomal protein MRP4" /protein_id="XP_460171.1" /db_xref="GeneID:2902867" ...

Active

... AGFRITNITDVTPIPHNGCRPPKKRRV" gene 347028..347648 /gene="rpsD" /locus_tag="AHA_RS01650" /old_locus_tag="AHA_0332" ...

Active

... misc_feature complement(917471..918253) /locus_tag="KPHS_08680" ... TIGR01709" /db_xref="CDD:273768" gene complement(928865..929818) ...

Active

... YHS" gene 100549..100824 /locus_tag="SPN034156_RS00535" /old_locus_tag="SPN034156_01070" CDS 100549..100824 ...

Active

... /db_xref="GeneID:5440818" mRNA join(280453..280911,280997..281674,281728..282668) ... /old_locus_tag="BC1G_01306" /product="hypothetical protein" ...

Active

/pseudo /codon_start=1 /transl_table=11 /product="ABC transporter permease subunit" gene complement(392936..394204) /locus_tag="LSEI_RS01875" ...

Active

... FIGLCLWPGANRANEYGSRRDAPAGD" gene complement(470207..471064) /gene="dapD" /locus_tag="SM_RS02205" /old_locus_tag="SMc01732" CDS ...

Active

... gene complement(215224..216873) /locus_tag="TDE_RS00875" ... DMQFIIK" gene complement(302346..302960) /locus_tag="TDE_RS01335" ...

Active

... /locus_tag="ML_RS01335" CDS 347970..348326 /locus_tag="ML_RS01335" /inference="COORDINATES: protein motif:HMM:NF013646.1" /note="Derived by ...

Active

... gene complement(321202..321432) /locus_tag="SRU_RS01285" ... gene complement(864670..866382) /locus_tag="SRU_RS03515" ...

Active

... CDS 140331..141107 /gene="bioH" /locus_tag="YPO_RS01660" /old_locus_tag="YPO0129" /EC_number="3.1.1.85" /inference="COORDINATES: similar to ...

Active

... gene 265681..265926 /locus_tag="SMI_RS01405" CDS 265681..265926 ... NKEDAA" gene 743824..744192 /gene="rplL" /locus_tag="SMI_RS03960" ...

Active

... /product="5'/3'-nucleotidase SurE" /db_xref="GeneID:3170004" gene 340726..341454 /gene="pgeF" /locus_tag="TTH_RS01895" /old_locus_tag="TTHA0362" ...

Active

... /old_locus_tag="STY0151" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_459136.1" /note="Derived by automated computational analysis ...

Active

... /locus_tag="ECL_RS04300" /old_locus_tag="ECL_00890" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_459136.1" /note="Derived by ...

Active

... gene 403836..404540 /locus_tag="LP_RS01895" /old_locus_tag="lp_0449" ... gene 995052..995894 /locus_tag="LP_RS04680" /old_locus_tag="lp_1093" ...

Active

... order(488751..488759,488766..488768,488913..488924, 489000..489002 ... /gene="infB" /locus_tag="SAOUHSC_01246" /note="translation initiation factor ...

Active

... gene complement(330804..331757) /locus_tag="CYB_RS01480" ... gene complement(484805..485320) /locus_tag="CYB_RS14025" ...

Active

... 320740..320742,320746..320748,320944..320949, 320953..320958 ... exporter TauE/SafE; Region: TauE; pfam01925" /db_xref="CDD:307855" regulatory ...

Active

... 2mer" gene complement(281743..283485) /locus_tag="BMA_RS01205" ... 875393..875400 /note="simple sequence repeat 1mer-240" /rpt_family="SSR ...

Active

... DEYTYRVPIHLYYNIDYEDEYEDFVNSEGQVPLIDGRIISFDSLKRNGFDAISIDLID EKHSVRELLNEELS" gene complement(634076..634447) /gene="rbfA" ...

Active